Genome Property Types¶
There are six different types of Genome Properties (GP) represented.
| PATHWAY: | These represent groups of proteins that perform biochemical steps in order within a recognised enzymatic pathway. |
|---|---|
| METAPATH: | These represent a specific type of PATHWAY where one or more of the steps within the pathway are described by another Genome Property. For the purposes of calculation, METAPATHs are dependent on their respective GP steps. |
| SYSTEM: | These represent groups of proteins that work together to fulfil a role, but do not necessarily represent a traditional enzymatic pathway (for example, transport systems). |
| COMPLEX: | These represent stable macromolecular complexes. |
| GUILD: | These represent groups of proteins sharing overall function, but which do not represent a system. |
| CATEGORY: | These are organisational properties that allow the full set of genome properties to be arranged into a hierarchy. These properties are not calculated. |
Flatfile Format¶
Each Genome Property is represented by up to three files
- DESC file - a description of the GP and the constituent steps
- FASTA file - a concatenation of fasta files that resolve to a yes for each of the constituent steps
- status file - a record of binary flags recording whether the GP has been curated and is to be made public
DESC file¶
The tags used in the DESC file are listed below, along with the description of the field they relate to.
| AC | Accession ID |
| DE | Description/name of Genome Property |
| TP | Type |
| AU | Author |
| TH | Threshold |
| RN | Reference number |
| RM | PMID of reference |
| RT | Reference title |
| RA | Reference author |
| RL | Reference citation |
| DC | Database title |
| DR | Database link |
| PN | Parent accession ID |
| CC | Property description |
| ** | Private notes |
| – | Separator |
| SN | Step number |
| ID | Step ID |
| DN | Step display name (includes EC number if available) |
| RQ | Required step |
| EV | Evidence (includes whether sufficient) |
| TG | Gene Ontology (GO) ID |
| // | End |
The DESC file is formatted such that a single tag is included on each line, followed by 2 blank spaces, followed by the value of the field.
In the case of the property description (CC) and private notes (**) fields, the information may stretch accross multiple lines. The line length is limited to 80 characters (including the tag) and so any subsequent lines used must also carry the tag. See the PATHWAY example below.
AC GenProp0001
DE chorismate biosynthesis via shikimate
TP PATHWAY
AU Haft D
TH 2
RN [1]
RM 12636087
RT The biosynthesis of shikimate metabolites.
RA Knaggs AR;
RL Nat Prod Rep. 2003;20:119-136.
DC Shikimate and Chorismate Biosynthesis
DR IUBMB; misc; shikim;
DC Phenylalanine, Tyrosine and Tryptophan Biosynthesis
DR KEGG; map00400;
DC Chorismate biosynthesis
DR MetaCyc; ARO-PWY;
CC Chorismate is the final common intermediate in the biosynthesis of
CC phenylalanine, tyrosine and tryptophan (the aromatic amino acids) as
CC well as menaquinone, ubiquinone, salicylate and phenazine. Chorismate
CC D-erythrose 4-phosphate and phosphoenolpyruvate. This pathway is
CC widely distributed among microorganisms. Certain methanogenic
CC euarchaeota appear to be missing the first two steps of the pathway -
CC these may be catalyzed by as of yet uncharacterized enzymes.
** Archaea are hard to assign. It would appear that the chorismate
** pathway is at least partially present in archaea, since many synthesize
** aromatic amino acids and contain some of the enzymes covered by the
** present HMM-set. In particular, shikimate kinase appears to be absent
** in many archaea which contain the enzymes before and after it in the
** pathway (Archaeoglobus, Methanobacterium, Methanococcus, Pyrococcus)
** implying that there may be a non-orthologous enzyme. Similarly, the
** first two steps of the pathway appear to be missing in certain archaea
** but are found in others.
--
SN 1
ID phospho-2-dehydro-3-deoxyheptonate aldolase
DN phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54)
RQ 1
EV IPR006219; TIGR00034; sufficient;
TG GO:0009423;
EV IPR002480; TIGR01358; sufficient;
TG GO:0009423;
EV IPR006268; TIGR01361; sufficient;
TG GO:0009423;
EV IPR010210; TIGR01949; sufficient;
TG GO:0009423;
--
SN 2
ID 3-dehydroquinate synthase
DN 3-dehydroquinate synthase (EC 4.2.3.4)
RQ 1
EV IPR016037; TIGR01357; sufficient;
TG GO:0009423;
EV IPR002812; PF01959; sufficient;
TG GO:0009423;
--
SN 3
ID 3-dehydroquinate dehydratase
DN 3-dehydroquinate dehydratase (EC 4.2.1.10)
RQ 1
EV IPR001874; TIGR01088; sufficient;
TG GO:0009423;
EV IPR001381; TIGR01093; sufficient;
TG GO:0009423;
--
SN 4
ID shikimate 5-dehydrogenase
DN shikimate 5-dehydrogenase (EC 1.1.1.25)
RQ 1
EV IPR011342; TIGR00507; sufficient;
TG GO:0009423;
EV IPR010110; TIGR01809; sufficient;
TG GO:0009423;
--
SN 5
ID shikimate kinase
DN shikimate kinase (EC 2.7.1.71)
RQ 1
EV IPR031322; PF01202; sufficient;
TG GO:0009423;
EV IPR010189; TIGR01920; sufficient;
TG GO:0009423;
--
SN 6
ID 3-phosphoshikimate 1-carboxyvinyltransferase
DN 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)
RQ 1
EV IPR006264; TIGR01356; sufficient;
TG GO:0009423;
--
SN 7
ID chorismate synthase
DN chorismate synthase (EC 4.2.3.5)
RQ 1
EV IPR000453; TIGR00033; sufficient;
TG GO:0009423;
//
While the layout of the DESC file for CATEGORY type properties follows the same format, the steps do not refer to calculable evidence. In the case of CATEGORY, the steps define the properties (including other sub-categories) that exist as children of the CATEGORY. See the CATEGORY example below.
AC GenProp0063
DE Biosynthesis
TP CATEGORY
AU Haft DH
TH 0
CC The process of creating complex biomolecules from simpler starting
CC materials.
--
SN 1
ID Natural products biosynthesis
RQ 0
EV GenProp0077;
--
SN 2
ID Amino acid biosynthesis
RQ 0
EV GenProp0126;
--
SN 3
ID Cofactor biosynthesis
RQ 0
EV GenProp0184;
--
SN 4
ID Nucleotide biosynthesis
RQ 0
EV GenProp0185;
--
SN 5
ID Storage and structural polymer biosynthesis
RQ 0
EV GenProp0186;
//
FASTA file¶
The FASTA file includes fasta sequences that are a match for each constituent step of the property. GPs of type CATEGORY do not have associated FASTA files as they do not contain any calculable steps. Similarly, a METAPATH which contains only GPs as evidence for its steps, would not have an associated FASTA file. The FASTA file is formatted such that each individual block of fasta sequence includes a descriptive header line, in the format provided by UniProt. The appropriate step number is then added to this header line in parenthesis, as shown below.
>sp|P0AB91|AROG_ECOLI (Step num: 1) Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive OS=Escherichia coli (strain K12) GN=aroG PE=1 SV=1
An example FASTA file is shown here:
>sp|P0AB91|AROG_ECOLI (Step num: 1) Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive OS=Escherichia coli (strain K12) GN=aroG PE=1 SV=1
MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGP
CSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQIN
DGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPN
YSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVM
VESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARRG
>sp|P07639|AROB_ECOLI (Step num: 2) 3-dehydroquinate synthase OS=Escherichia coli (strain K12) GN=aroB PE=1 SV=1
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS
GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA
GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ
SA
>sp|P05194|AROD_ECOLI (Step num: 3) 3-dehydroquinate dehydratase OS=Escherichia coli (strain K12) GN=aroD PE=1 SV=2
MKTVTVKDLVIGTGAPKIIVSLMAKDIASVKSEALAYREADFDILEWRVDHYADLSNVES
VMAAAKILRETMPEKPLLFTFRSAKEGGEQAISTEAYIALNRAAIDSGLVDMIDLELFTG
DDQVKETVAYAHAHDVKVVMSNHDFHKTPEAEEIIARLRKMQSFDADIPKIALMPQSTSD
VLTLLAATLEMQEQYADRPIITMSMAKTGVISRLAGEVFGSAATFGAVKKASAPGQISVN
DLRTVLTILHQA
>sp|P15770|AROE_ECOLI (Step num: 4) Shikimate dehydrogenase (NADP(+)) OS=Escherichia coli (strain K12) GN=aroE PE=1 SV=1
METYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSAGGKGANV
TVPFKEEAFARADELTERAALAGAVNTLMRLEDGRLLGDNTDGVGLLSDLERLSFIRPGL
RILLIGAGGASRGVLLPLLSLDCAVTITNRTVSRAEELAKLFAHTGSIQALSMDELEGHE
FDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGM
LVAQAAHAFLLWHGVLPDVEPVIKQLQEELSA
>sp|P0A6D7|AROK_ECOLI (Step num: 5) Shikimate kinase 1 OS=Escherichia coli (strain K12) GN=aroK PE=1 SV=2
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLHVETPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
>sp|P0A6D3|AROA_ECOLI (Step num: 6) 3-phosphoshikimate 1-carboxyvinyltransferase OS=Escherichia coli (strain K12) GN=aroA PE=1 SV=1
MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTAL
GVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPR
MKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTA
PLAPEDTVIRIKGDLVSKPYIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVE
GDASSASYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGE
LNAIDMDMNHIPDAAMTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVE
EGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
ARISQAA
>sp|P12008|AROC_ECOLI (Step num: 7) Chorismate synthase OS=Escherichia coli (strain K12) GN=aroC PE=1 SV=4
MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR
EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY
RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC
PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV
KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV
PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPR
W
Status file¶
Each GP has an associated ‘status’ file which records (using binary flags) whether the property has been curated, and whether it is to be made public. This file is edited by the curator as part of the curation process prior to release. Private curator notes can be included below the double hyphen. An example status file is shown here:
checked: 1
public: 0
--
contains a dependent GP that is not yet public